RNF5 Protein, Human (Cell-Free, His)

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of RNF5 Protein, Human (Cell-Free, His) is 179 a.a., with molecular weight of27 kDa&54 kDa& 108 kDa.

RNF5 Protein, a membrane-bound E3 ubiquitin-protein ligase, plays a pivotal role in the ubiquitination of target proteins, exhibiting diverse cellular functions. Teaming up with E2 ubiquitin-conjugating enzymes such as UBE2D1/UBCH5A and UBE2D2/UBC4, RNF5 orchestrates ubiquitination processes with a broad substrate range. Notably, it mediates the ubiquitination of PXN/paxillin, influencing cell motility and the cellular localization of PXN/paxillin. Additionally, RNF5 catalyzes the ubiquitination of Salmonella type III secreted protein sopA and JKAMP, modulating their functions. The 'Lys-63'-linked polyubiquitination of JKAMP regulates its association with the proteasome and ERAD components, while the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leads to proteasomal degradation, impacting antiviral responses. Furthermore, RNF5 catalyzes the ubiquitination and subsequent degradation of ATG4B, providing a mechanism to inhibit autophagy. These diverse activities highlight the versatile regulatory role of RNF5 in cellular processes.

Human

E. coli Cell-free

N-10*His

Q99942 (A2-I180)

6048

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

27 kDa&54 kDa&108 kDa. It is speculated that the protein forms a multimer structure.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.