1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. RNF5 Protein, Human (Cell-Free, His)

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of RNF5 Protein, Human (Cell-Free, His) is 179 a.a., with molecular weight of27 kDa&54 kDa& 108 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of RNF5 Protein, Human (Cell-Free, His) is 179 a.a., with molecular weight of27 kDa&54 kDa& 108 kDa.

Background

RNF5 Protein, a membrane-bound E3 ubiquitin-protein ligase, plays a pivotal role in the ubiquitination of target proteins, exhibiting diverse cellular functions. Teaming up with E2 ubiquitin-conjugating enzymes such as UBE2D1/UBCH5A and UBE2D2/UBC4, RNF5 orchestrates ubiquitination processes with a broad substrate range. Notably, it mediates the ubiquitination of PXN/paxillin, influencing cell motility and the cellular localization of PXN/paxillin. Additionally, RNF5 catalyzes the ubiquitination of Salmonella type III secreted protein sopA and JKAMP, modulating their functions. The 'Lys-63'-linked polyubiquitination of JKAMP regulates its association with the proteasome and ERAD components, while the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leads to proteasomal degradation, impacting antiviral responses. Furthermore, RNF5 catalyzes the ubiquitination and subsequent degradation of ATG4B, providing a mechanism to inhibit autophagy. These diverse activities highlight the versatile regulatory role of RNF5 in cellular processes.

Species

Human

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q99942 (A2-I180)

Gene ID

6048

Molecular Construction
N-term
10*His
RNF5 (A2-I180)
Accession # Q99942
C-term
Synonyms
E3 ubiquitin-protein ligase RNF5; RING finger protein 5; Ram1 homolog; HsRma1
AA Sequence

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Molecular Weight

27 kDa&54 kDa&108 kDa. It is speculated that the protein forms a multimer structure.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RNF5 Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF5 Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702425
Quantity:
MCE Japan Authorized Agent: