1. Recombinant Proteins
  2. Others
  3. ROM1 Protein, Human (His)

ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.

Background

ROM1 protein is implicated in rod outer segment (ROS) morphogenesis and, in collaboration with PRPH2, contributes to maintaining the structure of curved disks within the ROS. Additionally, it plays a vital role in organizing the ROS and preserving the diameter of its disks. Beyond its role in the visual system, ROM1 is involved in maintaining the outer nuclear layer of the retina. It forms homodimers and homotetramers, with the latter participating in higher-order complex formation through intermolecular disulfide bonds. ROM1 also forms heterotetramers with PRPH2 and interacts with proteins such as STX3 and SNAP25, suggesting its involvement in complex cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q03395 (P126-D263)

Gene ID
Molecular Construction
N-term
His
ROM1 (P126-D263)
Accession # Q03395
C-term
Synonyms
Rod outer segment membrane protein 1; ROSP1; Tspan-23; ROM1; TSPAN23
AA Sequence

PGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQD

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ROM1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ROM1 Protein, Human (His)
Cat. No.:
HY-P74594
Quantity:
MCE Japan Authorized Agent: