ROR1 Protein, Human (HEK293, His)

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It functions as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, in the inner ear, ROR1 is crucial for facilitating the innervation of auditory hair cells by spiral ganglion neurons.

Immobilized Recombinant Human ROR1 (C-6His) at 2 μg/mL (100 μl/well) can bind Human ROR1 Antibody(3E8). The ED₅₀ of Human ROR1 Antibody(3E8) is less than 10 ng/mL.

Human

HEK293

C-6*His

Q01973-1 (Q30-E403)

4919  [NCBI]

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

60-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.