1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. ROR1 Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. ROR family
  5. ROR1 Protein, Rat (HEK293, His)

ROR1 Protein, a crucial member of the Tyr protein kinase family within the protein kinase superfamily, plays a key role in cellular signaling and regulation as a tyrosine kinase. Its classification emphasizes its significance in phosphorylation events, sharing conserved features with related kinases. Studying ROR1 contributes to understanding its unique enzymatic functions and potential therapeutic applications. Further exploration promises insights into its broader impact on cellular signaling pathways and contributions to normal physiology and pathological conditions. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293, with C-10*His labeled tag. The total length of ROR1 Protein, Rat (HEK293, His) is 374 a.a., with molecular weight of 60-75 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ROR1 Protein, a crucial member of the Tyr protein kinase family within the protein kinase superfamily, plays a key role in cellular signaling and regulation as a tyrosine kinase. Its classification emphasizes its significance in phosphorylation events, sharing conserved features with related kinases. Studying ROR1 contributes to understanding its unique enzymatic functions and potential therapeutic applications. Further exploration promises insights into its broader impact on cellular signaling pathways and contributions to normal physiology and pathological conditions. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293, with C-10*His labeled tag. The total length of ROR1 Protein, Rat (HEK293, His) is 374 a.a., with molecular weight of 60-75 kDa.

Background

The ROR1 Protein is a key member of the protein kinase superfamily, specifically falling under the Tyr protein kinase family within the ROR subfamily. Its classification highlights its pivotal role as a tyrosine kinase, indicating its involvement in cellular signaling and regulation. As part of the protein kinase superfamily, ROR1 likely shares conserved structural and functional features with related kinases, underscoring its significance in phosphorylation events. The designation within the Tyr protein kinase family further emphasizes its specific role among tyrosine kinases, offering insights into its unique enzymatic functions. The study of ROR1 contributes to our understanding of its role in cellular processes related to tyrosine phosphorylation, presenting potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular signaling pathways. Further exploration of ROR1's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Biological Activity

Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.

  • Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.
Species

Rat

Source

HEK293

Tag

C-10*His

Accession

D3ZZ97/EDL97819.1 (Q30-E403)

Gene ID
Molecular Construction
N-term
ROR1 (Q30-E403)
Accession # D3ZZ97/EDL97819.1
10*His
C-term
Synonyms
ROR1; NTRKR1
AA Sequence

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Weight

60-75 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ROR1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P78617
Quantity:
MCE Japan Authorized Agent: