ROR1 Protein, Rat (HEK293, His)

ROR1 Protein, a crucial member of the Tyr protein kinase family within the protein kinase superfamily, plays a key role in cellular signaling and regulation as a tyrosine kinase. Its classification emphasizes its significance in phosphorylation events, sharing conserved features with related kinases. Studying ROR1 contributes to understanding its unique enzymatic functions and potential therapeutic applications. Further exploration promises insights into its broader impact on cellular signaling pathways and contributions to normal physiology and pathological conditions. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293, with C-10*His labeled tag. The total length of ROR1 Protein, Rat (HEK293, His) is 374 a.a., with molecular weight of 60-75 kDa.

The ROR1 Protein is a key member of the protein kinase superfamily, specifically falling under the Tyr protein kinase family within the ROR subfamily. Its classification highlights its pivotal role as a tyrosine kinase, indicating its involvement in cellular signaling and regulation. As part of the protein kinase superfamily, ROR1 likely shares conserved structural and functional features with related kinases, underscoring its significance in phosphorylation events. The designation within the Tyr protein kinase family further emphasizes its specific role among tyrosine kinases, offering insights into its unique enzymatic functions. The study of ROR1 contributes to our understanding of its role in cellular processes related to tyrosine phosphorylation, presenting potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular signaling pathways. Further exploration of ROR1's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED₅₀ of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×10³ units/mg.

• 
  Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED₅₀ of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.

Rat

HEK293

C-10*His

D3ZZ97/EDL97819.1 (Q30-E403)

362550  [NCBI]

QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

60-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.