1. Recombinant Proteins
  2. Others
  3. S100A1 Protein, Human (HEK293, hFc)

S100A1 Protein, Human (HEK293, hFc)

Cat. No.: HY-P74588
SDS COA Handling Instructions

The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100A1 Protein, Human (HEK293, hFc) is 93 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100A1 Protein, Human (HEK293, hFc) is 93 a.a., with molecular weight of ~40 kDa.

Background

The S100A1 gene encodes a protein that belongs to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are distributed in the cytoplasm and/or nucleus of various cells, playing roles in the regulation of cellular processes like cell cycle progression and differentiation. With at least 13 members located in a cluster on chromosome 1q21, this protein may be involved in stimulating Ca2+-induced Ca2+ release, inhibiting microtubule assembly, and impeding protein kinase C-mediated phosphorylation. Notably, decreased expression of S100A1 has been associated with cardiomyopathies, emphasizing its potential significance in heart-related conditions. The gene exhibits biased expression, particularly abundant in the heart, salivary gland, and select other tissues.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human S100A1 is immobilize at 1 μg/mL, 100 μL/well, it binds recombinant human HSP70/HSPA1A with the ED50 value of 2.259 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human S100A1 is immobilize at 1 μg/mL, 100 μL/well, it binds recombinant human HSP70/HSPA1A with the ED50 value of 2.259 μg/mL.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

NP_006262.1 (G2-S94)

Gene ID
Molecular Construction
N-term
hFc
S100A1 (G2-S94)
Accession # NP_006262.1
C-term
Synonyms
Protein S100-A1; S-100 protein alpha chain; S100A; S100A1; S100-alpha
AA Sequence

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Weight

Approximately 40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 10 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A1 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A1 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74588
Quantity:
MCE Japan Authorized Agent: