1. Recombinant Proteins
  2. Others
  3. S100A11 Protein, Mouse (His)

S100A11 Protein, Mouse (His)

Cat. No.: HY-P71269
SDS COA Handling Instructions

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

Background

S100A11 protein, also known as S100C or calgizzarin, plays a crucial role in the differentiation and cornification processes of keratinocytes, which are the main cells found in the outer layer of the skin. It functions as a homodimer, meaning it forms a complex consisting of two identical subunits. The dimerization occurs through disulfide linkages, where two sulfur atoms form a bond, contributing to the stability and structure of the protein. The S100A11 protein's involvement in keratinocyte differentiation and cornification suggests its significance in maintaining the integrity and barrier function of the skin.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P50543 (M1-I98)

Gene ID
Molecular Construction
N-term
6*His
S100A11 (M1-I98)
Accession # P50543
C-term
Synonyms
Protein S100-A11; Calgizzarin; Endothelial monocyte-activating polypeptide; EMAP; Protein S100-C; S100 calcium-binding protein A11; S100a11; S100c
AA Sequence

MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100A11 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A11 Protein, Mouse (His)
Cat. No.:
HY-P71269
Quantity:
MCE Japan Authorized Agent: