S100A11 Protein, Mouse (His)

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

S100A11 protein, also known as S100C or calgizzarin, plays a crucial role in the differentiation and cornification processes of keratinocytes, which are the main cells found in the outer layer of the skin. It functions as a homodimer, meaning it forms a complex consisting of two identical subunits. The dimerization occurs through disulfide linkages, where two sulfur atoms form a bond, contributing to the stability and structure of the protein. The S100A11 protein's involvement in keratinocyte differentiation and cornification suggests its significance in maintaining the integrity and barrier function of the skin.

Mouse

E. coli

N-6*His

P50543 (M1-I98)

20195  [NCBI]

MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI

Approximately 12.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.