S100A16 Protein, Human

S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free. The total length of S100A16 Protein, Human is 103 a.a., with molecular weight of ~12.0 kDa.

S100A16 is a calcium-binding protein known to bind one calcium ion per monomer. It has been implicated in various cellular processes, particularly in adipocyte differentiation. In vitro studies suggest that S100A16 can promote the differentiation of adipocytes. Notably, overexpression of S100A16 in preadipocytes has been associated with increased proliferation, enhanced adipogenesis, and a reduction in insulin-stimulated glucose uptake. The protein forms homodimers and has been shown to interact with TP53, suggesting a potential role in cellular signaling pathways. These findings underscore the multifaceted nature of S100A16, indicating its involvement in calcium-dependent processes and its impact on cellular differentiation and metabolic regulation.

Human

E. coli

Tag Free

Q96FQ6 (M1-S103)

140576  [NCBI]

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Approximately 12.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.