1. Recombinant Proteins
  2. Others
  3. S100A2 Protein, Human (HEK293, hFc)

Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100A2 Protein, Human (HEK293, hFc) is 97 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100A2 Protein, Human (HEK293, hFc) is 97 a.a., with molecular weight of ~40 kDa.

Background

Protein S100-A2 (S100A2) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth, chromosomal rearrangements and altered expression of S100A2 have been implicated in breast cancer[1][2].

Species

Human

Source

HEK293

Tag

N-hFc

Accession

NP_005969.1 (M2-P98)

Gene ID
Molecular Construction
N-term
hFc
S100A2 (M2-P98)
Accession # NP_005969.1
C-term
Synonyms
Protein S100-A2; CAN19; Protein S-100L; S100 calcium-binding protein A2; S100L  
AA Sequence

MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Weight

Approximately 40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 100 mM Glycine, 10 mM NaCl, 50 mM Tris, pH 7.5 or 50 mM Tris, 10 mM Nacl, 100 Glyane, PH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A2 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A2 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74585
Quantity:
MCE Japan Authorized Agent: