S100A3 Protein, Mouse (His)

S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.

Galectin-13, acting as a homodimer through disulfide linkages, demonstrates binding affinity for beta-galactoside and lactose. Additionally, it serves as a potent inducer of T-cell apoptosis, as evidenced by various studies. Moreover, Galectin-13 exhibits hemagglutinating activity specifically towards chicken erythrocytes. These properties highlight its multifaceted roles in cellular interactions and immune modulation.

Mouse

E. coli

N-6*His

P62818 (M1-Q101)

20197  [NCBI]

MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ

Approximately 12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.