S100A4 Protein, Human (C/N-His)

The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of S100A4 Protein, Human (C/N-His) is 101 a.a., with molecular weight of ~13 kDa.

S100A4 protein, a calcium-binding molecule, plays a versatile role in numerous cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Functionally, it enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, promoting filament depolymerization and increasing the amount of soluble myosin-IIA to facilitate chemotaxis. Additionally, S100A4 modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to a reduction in TP53 protein levels. In the extracellular space, it stimulates cytokine production and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. The protein forms homodimers and interacts with various partners, including PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, and FCGR3A, each interaction contributing to its diverse cellular functions. This intricate network of interactions underscores the multifaceted role of S100A4 in orchestrating cellular responses across different pathways.

Human

E. coli

N-6*His;C-6*His

P26447 (M1-K101)

6275  [NCBI]

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For lower concentration,please reconstitute in 50 mM Tris-HCL,300 mM NaCl, pH 7.4 buffer.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.