S100A4 Protein, Mouse (His)

The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.

The S100A4 protein is a calcium-binding protein that plays a vital role in various cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. It enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, leading to filament depolymerization and increased soluble myosin-IIA levels, ultimately resulting in the formation of stable protrusions that facilitate chemotaxis. Additionally, it modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to reduced TP53 protein levels. In the extracellular space, S100A4 stimulates cytokine production, such as granulocyte colony-stimulating factor and CCL24, from T-lymphocytes and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. It forms homodimers and interacts with PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, CXCR3, and FCGR3A, with the interaction with FCGR3A inhibiting PKC-dependent phosphorylation of FCGR3A.

Measured in a cell proliferation assay using U87 cells. The ED₅₀ for this effect is 7.658 ng/mL, corresponding to a specific activity is 1.306×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using U87 cells. The ED₅₀ for this effect is 7.658 ng/mL, corresponding to a specific activity is 1.306×10⁵ units/mg.

Mouse

E. coli

C-6*His

P07091 (M1-K101)

20198  [NCBI]

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Approximately 13.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.