1. Recombinant Proteins
  2. Others
  3. S100A4 Protein, Mouse (His)

The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE S100A4 Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.

Background

The S100A4 protein is a calcium-binding protein that plays a vital role in various cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. It enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, leading to filament depolymerization and increased soluble myosin-IIA levels, ultimately resulting in the formation of stable protrusions that facilitate chemotaxis. Additionally, it modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to reduced TP53 protein levels. In the extracellular space, S100A4 stimulates cytokine production, such as granulocyte colony-stimulating factor and CCL24, from T-lymphocytes and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. It forms homodimers and interacts with PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, CXCR3, and FCGR3A, with the interaction with FCGR3A inhibiting PKC-dependent phosphorylation of FCGR3A.

Biological Activity

Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 7.658 ng/mL, corresponding to a specific activity is 1.306×105 units/mg.

  • Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 7.658 ng/mL, corresponding to a specific activity is 1.306×105 units/mg.
Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P07091 (M1-K101)

Gene ID
Molecular Construction
N-term
S100A4 (M1-K101)
Accession # P07091
6*His
C-term
Synonyms
Protein S100-A4; Metastasin; Metastatic cell protein; PEL98; Placental calcium-binding protein; Protein 18A2; Protein Mts1; S100 calcium-binding protein A4; S100a4; Capl; Mts1
AA Sequence

MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Molecular Weight

Approximately 13.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A4 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A4 Protein, Mouse (His)
Cat. No.:
HY-P71084
Quantity:
MCE Japan Authorized Agent: