S100A6 Protein, Human (His)

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A6 Protein, Human (His) is 90 a.a., with molecular weight of ~12.0 kDa.

The S100A6 Protein serves as a pivotal calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A6 indirectly participates in diverse physiological processes, such as the reorganization of the actin cytoskeleton and cell motility. Existing as a homodimer with a head-to-tail assembly of two subunits, S100A6 binds two calcium ions in a cooperative manner. Its calcium-dependent interaction with CACYBP, ANXA2, ANXA11, SUGT1, and tropomyosin reveals its role in orchestrating complex molecular interactions. Moreover, S100A6 interacts with TP53, displaying higher affinity for TP53 phosphorylated on its N-terminal domain and lower affinity for TP53 phosphorylated on its C-terminal domain. The interaction with PPP5C, mediated by TPR repeats, is calcium-dependent and modulates PPP5C activity, emphasizing S100A6's regulatory influence in cellular processes. Additionally, its interaction with TPPP inhibits TPPP dimerization, as reported in recent studies.

Human

E. coli

N-6*His

P06703 (M1-G90)

6277  [NCBI]

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Approximately 12.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.