S100A7A Protein, Human (P.pastoris, His)

The S100A7A protein plays potential roles in skin homeostasis, epidermal differentiation, and inflammation, suggesting its importance in skin health and disease. Its involvement in cellular functions makes it a key factor in diseases such as psoriasis, which is characterized by abnormal epidermal processes and inflammation. S100A7A Protein, Human (P.pastoris, His) is the recombinant human-derived S100A7A protein, expressed by P. pastoris , with N-His labeled tag.

S100A7A Protein emerges as a potential player in epidermal differentiation and inflammation, suggesting a pivotal role in the intricate processes that contribute to skin homeostasis and immune response. Its implication in these cellular functions positions S100A7A as a potentially significant factor in the pathogenesis of diseases such as psoriasis, where aberrant epidermal differentiation and inflammation play key roles. The dual involvement in epidermal processes and inflammatory responses underscores the potential multifaceted impact of S100A7A on skin health and disease. Further exploration of its specific mechanisms and interactions may deepen our understanding of S100A7A's role in skin physiology and its potential implications in various pathological contexts, particularly those related to skin disorders and inflammatory conditions.

Human

P. pastoris

N-His

Q86SG5 (S2-Q101)

338324  [NCBI]

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Approximately 13.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.