S100A8 Protein, Rat (His)

S100A8 protein functions as a danger signal in inflammation, activating innate immune cells by binding to receptors like Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). This triggers signaling pathways that enhance the pro-inflammatory response. S100A8 Protein, Rat (His) is the recombinant rat-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag. The total length of S100A8 Protein, Rat (His) is 89 a.a., with molecular weight of ~13.0 kDa.

S100A8 is a molecule that plays a role in inflammation and immune response. It acts as a danger signal and stimulates innate immune cells by binding to receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). This binding activates signaling pathways that amplify the pro-inflammatory response.

Rat

E. coli

C-6*His

P50115 (M1-E89)

116547  [NCBI]

MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Approximately 13.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.