1. Recombinant Proteins
  2. Others
  3. S100A9 Protein, Canine (His)

S100A9 Protein, Canine (His)

Cat. No.: HY-P77830
Data Sheet SDS COA Handling Instructions

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Canine (His) is the recombinant canine-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg USD 160 In-stock
50 μg USD 305 In-stock
100 μg USD 490 In-stock
> 100 μg   Get quote  

Get it December 24 by noon. Order within 14 hrs 46 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Canine (His) is the recombinant canine-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

Background

S100A9, a calcium- and zinc-binding protein, plays a pivotal role in regulating inflammatory processes and immune responses. Its diverse functions include inducing neutrophil chemotaxis, adhesion, and enhancing the bactericidal activity of neutrophils through SYK, PI3K/AKT, and ERK1/2 activation, as well as promoting phagocytosis. Often found in the form of calprotectin (S100A8/A9), it serves intra- and extracellular roles, including facilitating leukocyte arachidonic acid trafficking and NADPH-oxidase activation intracellularly. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities, recruiting leukocytes, promoting cytokine and chemokine production, and regulating leukocyte adhesion and migration. Functioning as an alarmin or DAMP molecule, S100A9 stimulates innate immune cells via Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways. With antimicrobial activity against bacteria and fungi, it likely acts by chelating Zn(2+), essential for microbial growth. S100A9 can induce cell death through autophagy and apoptosis via mitochondrial-lysosomal cross-talk involving BNIP3 and regulates neutrophil number and apoptosis, acting as an anti-apoptotic factor. Its role as an oxidant scavenger protects against tissue damage by scavenging oxidants. Notably, S100A9 can act as a potent amplifier of inflammation in autoimmunity, cancer development, and tumor spread. It also exhibits transnitrosylase activity, contributing to S-nitrosylation of various targets, and forms complexes with other proteins, such as the iNOS-S100A8/A9 transnitrosylase complex, indicating its multifaceted involvement in immune regulation and inflammatory responses.

Species

Canine

Source

E. coli

Tag

N-His

Accession

A0A8I3MFK0/XP_038528057 (M1-H130)

Gene ID
Molecular Construction
N-term
His
S100A9 (M1-H130)
Accession # A0A8I3MFK0/XP_038528057
C-term
Synonyms
S100-A9; Calgranulin-B; Calprotectin L1H subunit; MRP-14; p14; CAGB; MRP14
AA Sequence

MADQMSQLECSIETIINIFHQYSVRLEHPDKLNQKEMKQLVKKELPNFLKKQKKNDNAINKIMEDLDTNGDKELNFEEFSILVARLTVASHEEMHKNAPEGEGHSHGPGFGEGSQGHCHSHGGHGHGHSH

Molecular Weight

Approximately 15.90 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 1 mM DTT, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A9 Protein, Canine (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A9 Protein, Canine (His)
Cat. No.:
HY-P77830
Quantity:
MCE Japan Authorized Agent: