1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein
  6. SARS-CoV-2 S glycoprotein (D614G, HEK293, His)

SARS-CoV-2 S glycoprotein (D614G, HEK293, His)

Cat. No.: HY-P72036
Handling Instructions Technical Support

SARS-CoV-2 S glycoprotein (D614G, HEK 293, His) is a SARS-CoV-2 S glycoprotein D614G protein with a His-flag. SARS-CoV-2 S glycoprotein (D614G) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change D614G, this variant has become the most prevalent form and has been associated with greater infectivity.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SARS-CoV-2 S glycoprotein (D614G, HEK 293, His) is a SARS-CoV-2 S glycoprotein D614G protein with a His-flag. SARS-CoV-2 S glycoprotein (D614G) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change D614G, this variant has become the most prevalent form and has been associated with greater infectivity[1].

Background

SARS-CoV-2, causes the global pandemic coronavirus disease 2019 (Covid-19). SARS-CoV-2 belongs to a family of viruses known as coronaviruse. SARS-CoV-2 is the third human coronavirus this century known to cause pneumonia with a significant case-fatality rate.
SARS-CoV-2 is comprised of four structural proteins: Spike protein (S protein), Envelope protein (E), Membrane protein (M), and Nucleocapsid protein (N).
D614G does not alter S protein synthesis, processing, or incorporation into SARS-CoV-2 particles, but D614G affinity for ACE2 is reduced due to a faster dissociation rate.  The D614G substitution results in significantly higher pseudovirus titres in multiple cell types, suggesting that spike G614 might be associated with enhanced entry into cells and enhanced replication in airways[1][2].

Species

Virus

Source

HEK293

Tag

C-10*His

Accession

P0DTC2 (V16-R685, D614G)

Gene ID
Molecular Construction
N-term
S glycoprotein (V16-R685, D614G)
Accession # P0DTC2
10*His
C-term
Synonyms
E2 Peplomer protein
AA Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Weight

Approximately 77.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

SARS-CoV-2 S glycoprotein (D614G, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S glycoprotein (D614G, HEK293, His)
Cat. No.:
HY-P72036
Quantity:
MCE Japan Authorized Agent: