SARS-CoV-2 S glycoprotein (D614G, HEK293, His)

SARS-CoV-2 S glycoprotein (D614G, HEK 293, His) is a SARS-CoV-2 S glycoprotein D614G protein with a His-flag. SARS-CoV-2 S glycoprotein (D614G) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change D614G, this variant has become the most prevalent form and has been associated with greater infectivity^[1].

SARS-CoV-2, causes the global pandemic coronavirus disease 2019 (Covid-19). SARS-CoV-2 belongs to a family of viruses known as coronaviruse. SARS-CoV-2 is the third human coronavirus this century known to cause pneumonia with a significant case-fatality rate.
SARS-CoV-2 is comprised of four structural proteins: Spike protein (S protein), Envelope protein (E), Membrane protein (M), and Nucleocapsid protein (N).
D614G does not alter S protein synthesis, processing, or incorporation into SARS-CoV-2 particles, but D614G affinity for ACE2 is reduced due to a faster dissociation rate.  The D614G substitution results in significantly higher pseudovirus titres in multiple cell types, suggesting that spike G614 might be associated with enhanced entry into cells and enhanced replication in airways^[1][2].

Virus

HEK293

C-10*His

P0DTC2 (V16-R685, D614G)

43740568  [NCBI]

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Approximately 77.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Leonid Yurkovetskiy, et al. Structural and Functional Analysis of the D614G SARS-CoV-2 Spike Protein Variant. Cell. 2020 Oct 29;183(3):739-751.e8.  [Content Brief]

  [2]. Jessica A Plante, et al. Spike mutation D614G alters SARS-CoV-2 fitness. Nature. 2021 Apr;592(7852):116-121.  [Content Brief]