1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein RBD
  6. SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His)

SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His)

Cat. No.: HY-P7431A
SDS COA Handling Instructions Technical Support

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His) is the recombinant Virus-derived SARS-CoV-2 S protein RBD, expressed by HEK293 , with C-6*His labeled tag. The total length of SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His) is 194 a.a., with molecular weight of ~31.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His) is the recombinant Virus-derived SARS-CoV-2 S protein RBD, expressed by HEK293 , with C-6*His labeled tag. The total length of SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His) is 194 a.a., with molecular weight of ~31.9 kDa.

Background

The SARS-CoV-2 S1 Protein plays a crucial role in the early stages of viral infection. Spike protein S1 facilitates the attachment of the virion to the cell membrane by interacting with host receptors, thereby initiating the infection process. This initial binding event is pivotal for the subsequent entry of the virus into the host cell. Concurrently, Spike protein S2', serving as a viral fusion peptide, comes into play after S2 cleavage during virus endocytosis. The unmasking of S2' is a key step in the viral fusion process, enabling the merging of the viral membrane with the endosomal membrane and facilitating the release of the viral genetic material into the host cell cytoplasm. The concerted action of these S1 and S2' functionalities underscores the significance of the SARS-CoV-2 S1 Protein in mediating viral entry and fusion, crucial steps in the viral life cycle.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse SARS-CoV-2 S1, at 2 μg/mL (100 μL/well) can bind Biotinylated ACE2 protein. The ED50 for this effect is 40.46 ng/mL, corresponding to a specific activity is 2.47×10^5 Unit/mg.

Species

Virus

Source

HEK293

Tag

C-6*His

Accession

QHD43416.1 (N331-V524)

Gene ID
Molecular Construction
N-term
Spike RBD (N331-V524)
Accession # QHD43416.1
6*His
C-term
Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
AA Sequence

NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVHHHHHH

Molecular Weight

Approximately 31.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S Protein RBD (194a.a, HEK293, C-His)
Cat. No.:
HY-P7431A
Quantity:
MCE Japan Authorized Agent: