SARS-CoV S Protein (HEK293, His-Myc)

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein (HEK293, His-Myc) is the recombinant Virus-derived SARS-CoV S protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag. The total length of SARS-CoV S Protein (HEK293, His-Myc) is 222 a.a., with molecular weight of ~37 kDa.

The SARS-CoV S protein is implicated in down-regulating host tetherin (BST2) through lysosomal degradation, thus counteracting its antiviral activity. In the context of infection, the S protein attaches the virion to the cell membrane by interacting with host receptors, initiating the viral entry process. The binding to human ACE2 and CLEC4M/DC-SIGNR receptors, coupled with the subsequent internalization of the virus into the endosomes of the host cell, induces conformational changes in the S glycoprotein. Additionally, proteolysis by cathepsin CTSL may unmask the fusion peptide of S2, activating membrane fusion within endosomes. These orchestrated events underscore the pivotal role of the SARS-CoV S protein in mediating viral entry and evading host antiviral defenses, shedding light on its significance in the pathogenesis of SARS-CoV infections. Further exploration is crucial to unveil the intricate molecular mechanisms underlying these processes and to identify potential targets for therapeutic interventions.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/mL can bind Paguma larvata ACE2 , the EC₅₀ is 33.37-79.47 ng/mL.

Virus

HEK293

N-10*His;C-Myc

P59594 (R306-F527)

1489668  [NCBI]

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Approximately 37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.