1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Spike Proteins
  5. SARS-CoV-2 S Protein
  6. SARS-CoV S Protein (HEK293, His-Myc)

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein (HEK293, His-Myc) is the recombinant Virus-derived SARS-CoV S protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag. The total length of SARS-CoV S Protein (HEK293, His-Myc) is 222 a.a., with molecular weight of ~37 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein (HEK293, His-Myc) is the recombinant Virus-derived SARS-CoV S protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag. The total length of SARS-CoV S Protein (HEK293, His-Myc) is 222 a.a., with molecular weight of ~37 kDa.

Background

The SARS-CoV S protein is implicated in down-regulating host tetherin (BST2) through lysosomal degradation, thus counteracting its antiviral activity. In the context of infection, the S protein attaches the virion to the cell membrane by interacting with host receptors, initiating the viral entry process. The binding to human ACE2 and CLEC4M/DC-SIGNR receptors, coupled with the subsequent internalization of the virus into the endosomes of the host cell, induces conformational changes in the S glycoprotein. Additionally, proteolysis by cathepsin CTSL may unmask the fusion peptide of S2, activating membrane fusion within endosomes. These orchestrated events underscore the pivotal role of the SARS-CoV S protein in mediating viral entry and evading host antiviral defenses, shedding light on its significance in the pathogenesis of SARS-CoV infections. Further exploration is crucial to unveil the intricate molecular mechanisms underlying these processes and to identify potential targets for therapeutic interventions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 μg/mL can bind Paguma larvata ACE2 , the EC50 is 33.37-79.47 ng/mL.

Species

Virus

Source

HEK293

Tag

N-10*His;C-Myc

Accession

P59594 (R306-F527)

Gene ID

1489668  [NCBI]

Molecular Construction
N-term
10*His-Myc
SARS-CoV S (R306-F527)
Accession # P59594
C-term
Synonyms
S glycoprotein; E2; Peplomer protein; Spike protein S1; Spike protein S2;
AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Molecular Weight

Approximately 37 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SARS-CoV S Protein (HEK293, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV S Protein (HEK293, His-Myc)
Cat. No.:
HY-P72045
Quantity:
MCE Japan Authorized Agent: