1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SCF Protein, Rat (P.pastoris)

SCF Protein, Rat (P.pastoris)

Cat. No.: HY-P7107
COA Handling Instructions

SCF Protein, Rat (P.pastoris) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $180 In-stock
50 μg $360 In-stock
100 μg $600 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SCF Protein, Rat (P.pastoris) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.

Background

Stem Cell Factor is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. Stem Cell Factor (SCF) is applied for hematopoietic stem cell mobilization, exvivo stem/progenitor cell expansion, gene therapy, and immunotherapy[1]. Stem Cell Factor regulates cell survival, proliferation, differentiation, and migration in divergent cell types[2].

Biological Activity

The ED50 is <25 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >4 × 104 units/mg.

Species

Rat

Source

P. pastoris

Tag

Tag Free

Accession

P21581-1 (Q26-A189)

Gene ID

60427  [NCBI]

Molecular Construction
N-term
SCF (Q26-A189)
Accession # P21581-1
C-term
Synonyms
rRtSCF; Hematopoietic growth factor KL; MGF; Mast Cell Growth Factor
AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Weight

Approximately 18.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

SCF Protein, Rat (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCF Protein, Rat (P.pastoris)
Cat. No.:
HY-P7107
Quantity:
MCE Japan Authorized Agent: