SCGB1A1 Protein, Rat (His)

SCGB1A1 Protein demonstrates diverse binding abilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and, to a lesser extent, progesterone.It acts as a robust phospholipase A2 inhibitor, forming an antiparallel homodimer linked by disulfide bonds.Although there is controversy regarding its interaction with LMBR1L, additional research is necessary for clarification.SCGB1A1 Protein, Rat (His) is the recombinant rat-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

SCGB1A1 protein exhibits versatile binding capabilities, including phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and progesterone to a lesser extent. It serves as a potent inhibitor of phospholipase A2. Structurally, it forms an antiparallel homodimer that is disulfide-linked. While there is some controversy surrounding its interaction with LMBR1L, further investigation is required to clarify this aspect.

Measured by the ability of the immobilized protein to affect the adhesion of the A549 human lung carcinoma cells in the presence of Fibronectin. The ED₅₀ for this effect is 3.142 μg/mL, corresponding to a specific activity is 318.27 units/mg.

• 
  Measured by the ability of the immobilized protein to affect the adhesion of the A549 human lung carcinoma cells in the presence of Fibronectin. The ED₅₀ for this effect is 3.142 μg/mL, corresponding to a specific activity is 318.27 units/mg.

Rat

E. coli

N-6*His

P17559 (S20-V96)

25575  [NCBI]

SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.