1. Recombinant Proteins
  2. Others
  3. SCN2B Protein, Human (HEK293, His)

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCN2B protein is a key subunit of voltage-gated sodium channels and plays an important role in regulating channel function by interacting with the pore-forming α subunit. This interaction regulates the flux of sodium ions across the cell membrane, affecting neuronal excitability and action potential propagation. SCN2B Protein, Human (HEK293, His) is the recombinant human-derived SCN2B protein, expressed by HEK293 , with C-His labeled tag.

Background

CSRP1, a protein with potential implications in neuronal development, engages in interactions with ASCC1, ASCC2, and TRIP4, suggesting a role in cellular processes. On the other hand, LCN1, also known as Lipocalin-1, emerges as a candidate involved in taste reception and the gustatory system. It may contribute to the concentration and delivery of sapid molecules, showcasing its potential role in sensory perception. With a broad ligand-binding capability, LCN1 accommodates a range of ligands, spanning lipids, retinoids, the antibiotic rifampicin, and microbial siderophores, reflecting its versatile ligand pocket. While predominantly existing as a monomer, LCN1 may also form homodimers. Notably, its interaction with LMBR1L mediates the endocytosis of LCN1, revealing a layer of regulatory complexity in its cellular functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O60939 (M30-A159)

Gene ID
Molecular Construction
N-term
SCN2B (M30-A159)
Accession # O60939
His
C-term
Synonyms
Sodium channel subunit beta-2; SCN2B
AA Sequence

MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVA

Molecular Weight

Approximately 21-34 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SCN2B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCN2B Protein, Human (HEK293, His)
Cat. No.:
HY-P76052
Quantity:
MCE Japan Authorized Agent: