1. Recombinant Proteins
  2. Others
  3. SCO1 Protein, Human (GST)

SCO1 Protein, Human (GST)

Cat. No.: HY-P71040
COA Handling Instructions

The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag. The total length of SCO1 Protein, Human (GST) is 170 a.a., with molecular weight of ~20.40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag. The total length of SCO1 Protein, Human (GST) is 170 a.a., with molecular weight of ~20.40 kDa.

Background

SCO1 protein serves as a copper metallochaperone crucial for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Although not directly involved in MT-CO2/COX2 synthesis, SCO1 plays an indispensable role in stabilizing MT-CO2/COX2 during its subsequent maturation process, facilitating the transport of copper to the Cu(A) site on MT-CO2/COX2. Beyond its role in mitochondrial function, SCO1 is a key regulator of copper homeostasis, influencing the abundance and cell membrane localization of the copper transporter CTR1. Existing as a homodimer, SCO1 interacts with various partners such as COA6, COX20, COX18, and SCO2, forming complexes critical for the coordination of copper transport and utilization. Notably, SCO1's interactions with COX20, TMEM177, and COX16 are intricately regulated, providing insights into the intricate network of proteins involved in mitochondrial copper homeostasis and cytochrome c oxidase maturation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

O75880 (G132-S301)

Gene ID
Molecular Construction
N-term
GST
SCO1 (G132-S301)
Accession # O75880
C-term
Synonyms
Protein SCO1 Homolog Mitochondrial; SCO1; SCOD1
AA Sequence

GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS

Molecular Weight

Approximately 20.40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM PB, 1 mM DTT, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SCO1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCO1 Protein, Human (GST)
Cat. No.:
HY-P71040
Quantity:
MCE Japan Authorized Agent: