SDC4 Protein, Mouse (HEK293, Fc)

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-hFc labeled tag.

Syndecan-4 (SDC4) is a cell surface proteoglycan that plays a crucial role in regulating exosome biogenesis in collaboration with SDCBP and PDCD6IP. As a homodimer, SDC4 engages in various protein interactions, including binding with CDCP1 and SDCBP, suggesting its involvement in diverse cellular processes. Through its cytoplasmic domain, SDC4 forms interactions with GIPC, specifically through the PDZ domain, and with NUDT16L1. These associations highlight the multifunctional nature of SDC4, suggesting its participation in intricate cellular signaling pathways and the regulation of exosome dynamics.

1.Measured by its binding ability in a functional ELISA.Immobilized human MDK at 10 μg/mL (100 μl/well) can bind mouse SDC4-Fc with a linear range of 0.16-1.25 μg/mL.
2.Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 10⁴ cells/well are added to mouse Syndecan-4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED₅₀ for this effect is 2.984 μg/mL, corresponding to a specific activity is 3.35×10² U/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 10⁴ cells/well are added to mouse Syndecan-4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED₅₀ for this effect is 2.984 μg/mL, corresponding to a specific activity is 3.35×10² U/mg.

Mouse

HEK293

C-hFc

O35988 (E24-V146)

20971  [NCBI]

ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV

Approximately 50-55 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.