Serglycin/SRGN Protein, Human (HEK293, His)

Serglycin/SRGN Protein, Human (HEK293, His) is the recombinant human-derived Serglycin/SRGN, expressed by HEK293 , with C-10*His labeled tag. ,

Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×10⁵ units/mg.

Human

HEK293

C-10*His

CAA34900.1/AAA60179.1 (Y28-L158)

5552  [NCBI]

YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.