Serpin A3N Protein, Mouse (HEK293, His)

The serpin A3N protein is ubiquitously found in a variety of tissues, showing elevated expression in the brain, heart, liver, lung, spleen, testis, and thymus, implying a variety of physiological functions.In contrast, it shows lower expression in bone marrow, kidney, and skeletal muscle, suggesting a tissue-specific pattern of regulation.Serpin A3N Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A3N protein, expressed by HEK293 , with C-6*His labeled tag.

Serpin A3N protein, a ubiquitous player in various tissues, is expressed at elevated levels in the brain, heart, liver, lung, spleen, testis, and thymus. Its presence in these tissues underscores its potential involvement in diverse physiological functions within these organs. In contrast, Serpin A3N is expressed at lower levels in the bone marrow, kidney, and skeletal muscle, suggesting a differential regulatory pattern across tissues. The varying expression levels highlight the tissue-specific roles and regulatory mechanisms of Serpin A3N, emphasizing its importance in maintaining homeostasis and contributing to the functionality of specific organs and systems.

Mouse

HEK293

C-6*His

Q91WP6 (F21-K418)

20716  [NCBI]

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

57-61 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.