1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin A6
  6. Serpin A6 Protein, Mouse (HEK293, His)

Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag. The total length of Serpin A6 Protein, Mouse (HEK293, His) is 375 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag. The total length of Serpin A6 Protein, Mouse (HEK293, His) is 375 a.a., with molecular weight of 50-60 kDa.

Background

Serpin A6, also known as corticosteroid-binding globulin (CBG), is a glycoprotein that acts as a carrier for corticosteroids, including cortisol, in the bloodstream. CBG plays a crucial role in regulating the levels and availability of corticosteroids, which are important for various physiological processes, including stress response, immune function, and metabolism. It binds to cortisol with high affinity, influencing its distribution and activity in the body. Mutations or alterations in the SERPINA6 gene can impact CBG function and corticosteroid homeostasis.

Biological Activity

Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6. The ED50 for this effect is 5.447 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6 . The ED50 for this effect is 5.447 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q06770 (V23-A397)

Gene ID
Molecular Construction
N-term
Serpin A6 (V23-A397)
Accession # Q06770
His
C-term
Synonyms
Corticosteroid-binding globulin; CBG; Transcortin; SERPINA6
AA Sequence

VTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA

Molecular Weight

Approximately 50-80 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin A6 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A6 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73657
Quantity:
MCE Japan Authorized Agent: