Serpin A6 Protein, Mouse (HEK293, His)

Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag. The total length of Serpin A6 Protein, Mouse (HEK293, His) is 375 a.a., with molecular weight of 50-60 kDa.

Serpin A6, also known as corticosteroid-binding globulin (CBG), is a glycoprotein that acts as a carrier for corticosteroids, including cortisol, in the bloodstream. CBG plays a crucial role in regulating the levels and availability of corticosteroids, which are important for various physiological processes, including stress response, immune function, and metabolism. It binds to cortisol with high affinity, influencing its distribution and activity in the body. Mutations or alterations in the SERPINA6 gene can impact CBG function and corticosteroid homeostasis.

Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6. The ED₅₀ for this effect is 5.447 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6 . The ED₅₀ for this effect is 5.447 μg/mL.

Mouse

HEK293

C-His

Q06770 (V23-A397)

12401  [NCBI]

VTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA

Approximately 50-80 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.