Serpin B9 Protein, Human (HEK293, His)

The Serpin B9 Protein, a member of the serpin family, crucially regulates immune responses by specifically inhibiting granzyme B, a protease involved in immune cell-mediated apoptosis. Acting as a potent inhibitor, Serpin B9 modulates granzyme B's cytotoxic activity, fine-tuning immune responses and preventing unwarranted cell death, emphasizing its significance in maintaining immune balance. Serpin B9 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin B9 Protein, Human (HEK293, His) is 376 a.a., with molecular weight of 35-40 kDa.

The Serpin B9 Protein functions as a granzyme B inhibitor, playing a crucial role in regulating immune responses. As a member of the serpin family, this protein specifically targets and inhibits granzyme B, a protease involved in immune cell-mediated apoptosis. By acting as a potent inhibitor, Serpin B9 modulates the cytotoxic activity of granzyme B, thereby influencing key processes in immune defense and contributing to the fine-tuning of immune responses. The regulatory capacity of Serpin B9 highlights its significance in maintaining immune balance and preventing unwarranted cell death mediated by granzyme B.

Human

HEK293

C-6*His

P50453 (M1-P376)

5272  [NCBI]

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

35-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.