1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin B9
  6. Serpin B9 Protein, Human (HEK293, His)

The Serpin B9 Protein, a member of the serpin family, crucially regulates immune responses by specifically inhibiting granzyme B, a protease involved in immune cell-mediated apoptosis. Acting as a potent inhibitor, Serpin B9 modulates granzyme B's cytotoxic activity, fine-tuning immune responses and preventing unwarranted cell death, emphasizing its significance in maintaining immune balance. Serpin B9 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin B9 Protein, Human (HEK293, His) is 376 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Serpin B9 Protein, a member of the serpin family, crucially regulates immune responses by specifically inhibiting granzyme B, a protease involved in immune cell-mediated apoptosis. Acting as a potent inhibitor, Serpin B9 modulates granzyme B's cytotoxic activity, fine-tuning immune responses and preventing unwarranted cell death, emphasizing its significance in maintaining immune balance. Serpin B9 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin B9 Protein, Human (HEK293, His) is 376 a.a., with molecular weight of 35-40 kDa.

Background

The Serpin B9 Protein functions as a granzyme B inhibitor, playing a crucial role in regulating immune responses. As a member of the serpin family, this protein specifically targets and inhibits granzyme B, a protease involved in immune cell-mediated apoptosis. By acting as a potent inhibitor, Serpin B9 modulates the cytotoxic activity of granzyme B, thereby influencing key processes in immune defense and contributing to the fine-tuning of immune responses. The regulatory capacity of Serpin B9 highlights its significance in maintaining immune balance and preventing unwarranted cell death mediated by granzyme B.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P50453 (M1-P376)

Gene ID
Molecular Construction
N-term
Serpin B9 (M1-P376)
Accession # P50453
6*His
C-term
Synonyms
Cytoplasmic antiproteinase 3; Peptidase inhibitor 9; CAP3; PI-9; Serpin B9
AA Sequence

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

Molecular Weight

35-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin B9 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin B9 Protein, Human (HEK293, His)
Cat. No.:
HY-P71306
Quantity:
MCE Japan Authorized Agent: