Serpin F1 Protein, Human (HEK293, N-His)

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. Serpin F1 Protein, Human (HEK293, N-His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Serpin F1 Protein, Human (HEK293, N-His) is 399 a.a., with molecular weight of ~49.37 kDa.

Neurotrophic protein Serpin F1 plays a pivotal role in promoting extensive neuronal differentiation in retinoblastoma cells. Additionally, it functions as a potent inhibitor of angiogenesis. Notably, Serpin F1 does not undergo the S (stressed) to R (relaxed) conformational transition typical of active serpins, resulting in the absence of serine protease inhibitory activity. Furthermore, it interacts with PNPLA2, fostering the phospholipase A2 activity of PNPLA2.

Measured by its ability to enhance the adhesion of Saos-2 human osteosarcoma cells to bovine Collagen I coated plate. The ED₅₀ this effect is 0.2506 μg/mL, corresponding to a specific activity is 3.99×10³ units/mg.

• 
  Measured by its ability to enhance the adhesion of Saos-2 human osteosarcoma cells to bovine Collagen I coated plate. The ED₅₀ for this effect is 0.2506 μg/ml, corresponding to a specific activity is 3.99×10³ units/mg.

Human

HEK293

N-6*His

P36955 (Q20-P418)

5176  [NCBI]

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Approximately 49.37 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.