1. Recombinant Proteins
  2. Others
  3. Serum amyloid A-3 protein/Saa3 Protein, Mouse (P.pastoris, His)

Serum amyloid A-3 protein/Saa3 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71809
Handling Instructions Technical Support

Serum amyloid A-3 protein/SAA3 is an important acute-phase reactant that plays a key role in responding to acute physiological challenges.As an important apolipoprotein in high-density lipoprotein (HDL) complexes, SAA3 contributes to the regulation of lipid metabolism, demonstrating its multifaceted role in maintaining homeostasis.Serum amyloid A-3 protein/SAA3 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serum amyloid A-3 protein/SAA3 protein, expressed by P.pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serum amyloid A-3 protein/SAA3 is an important acute-phase reactant that plays a key role in responding to acute physiological challenges.As an important apolipoprotein in high-density lipoprotein (HDL) complexes, SAA3 contributes to the regulation of lipid metabolism, demonstrating its multifaceted role in maintaining homeostasis.Serum amyloid A-3 protein/SAA3 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serum amyloid A-3 protein/SAA3 protein, expressed by P.pastoris , with N-6*His labeled tag.

Background

Serum Amyloid A-3 Protein, also known as Saa3, emerges as a significant acute phase reactant with a pivotal role in the body's response to acute physiological challenges. As a crucial apolipoprotein within the high-density lipoprotein (HDL) complex, Saa3 contributes to the regulation of lipid metabolism, highlighting its multifaceted involvement in maintaining homeostasis. Notably, in vitro studies reveal its antimicrobial activity against Escherichia coli, Streptococcus uberis, and Pseudomonas aeruginosa, suggesting a potential role in the innate immune defense against bacterial pathogens. This dual functionality underscores the diverse and essential contributions of Saa3 in both the acute phase response and antimicrobial defense mechanisms.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P04918 (R20-Y122)

Gene ID

20210  [NCBI]

Molecular Construction
N-term
6*His
SAA3 (R20-Y122)
Accession # P04918
C-term
Synonyms
Saa3; Serum amyloid A-3 protein
AA Sequence

RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Molecular Weight

Approximately 15 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serum amyloid A-3 protein/Saa3 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serum amyloid A-3 protein/Saa3 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71809
Quantity:
MCE Japan Authorized Agent: