1. Recombinant Proteins
  2. Others
  3. Serum amyloid A protein, Cat (P.pastoris, His)

Serum amyloid A protein, Cat (P.pastoris, His)

Cat. No.: HY-P71780
Handling Instructions

Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serum amyloid A is a major acute phase reactant, plays a dynamic role in the acute phase response and serves as an essential apolipoprotein in high-density lipoprotein (HDL) complexes. Enhanced expression during the acute phase response reflects its overall involvement in the body's adaptive response to different challenges. Serum amyloid A protein, Cat (P.pastoris, His) is the recombinant cat-derived Serum amyloid A protein, expressed by P. pastoris , with N-His labeled tag.

Background

Serum Amyloid A Protein emerges as a key player in the acute phase response, serving as a major acute phase reactant. Its dynamic role extends to functioning as an essential apolipoprotein within the high-density lipoprotein (HDL) complex. During acute phase reactions, the heightened expression of Serum Amyloid A reflects its integral involvement in the body's adaptive response to diverse physiological challenges. Additionally, its role as an apolipoprotein emphasizes its contribution to the regulation of lipid metabolism, underscoring the multifaceted nature of Serum Amyloid A in maintaining homeostasis and responding to inflammatory stimuli.

Species

Cat

Source

P. pastoris

Tag

N-His

Accession

P19707 (E1-G90)

Gene ID

101099498

Molecular Construction
N-term
His
SAA1 (E1-G90)
Accession # P19707
C-term
Synonyms
SAA1; Serum amyloid A protein
AA Sequence

EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Molecular Weight

Approximately 12.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Serum amyloid A protein, Cat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serum amyloid A protein, Cat (P.pastoris, His)
Cat. No.:
HY-P71780
Quantity:
MCE Japan Authorized Agent: