SFRP1 Protein, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

SFRP1, a soluble frizzled-related protein (sFRP), functions as a modulator of Wnt signaling through its direct interaction with Wnts, contributing to the regulation of cell growth and differentiation in specific cell types. Notably, SFRP1 plays a role in decreasing intracellular beta-catenin levels, indicative of its influence on Wnt pathway components. Beyond its involvement in Wnt signaling, SFRP1 exhibits antiproliferative effects on vascular cells both in vitro and in vivo, inducing an angiogenic response in vivo. In the vascular cell cycle, it delays the G1 phase and entry into the S phase. In the context of kidney development, SFRP1 inhibits tubule formation and bud growth in metanephroi. Additionally, it hinders WNT1/WNT4-mediated TCF-dependent transcription and interacts with WNT1, WNT2, FRZD6, WNT4, WNT8, and MYOC, emphasizing its multifaceted role in cellular processes and molecular interactions.

Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells and the ED₅₀ is typically 5-30 μg/mL.

Human

HEK293

C-His

Q8N474 (S32-K314)

6422  [NCBI]

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Approximately 35-43 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.