1. Recombinant Proteins
  2. Others
  3. SFRP1 Protein, Human (HEK293, His)

SFRP1 Protein, Human (HEK293, His)

Cat. No.: HY-P74554
COA Handling Instructions

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $115 In-stock
20 μg $185 Get quote
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

SFRP1 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Background

SFRP1, a soluble frizzled-related protein (sFRP), functions as a modulator of Wnt signaling through its direct interaction with Wnts, contributing to the regulation of cell growth and differentiation in specific cell types. Notably, SFRP1 plays a role in decreasing intracellular beta-catenin levels, indicative of its influence on Wnt pathway components. Beyond its involvement in Wnt signaling, SFRP1 exhibits antiproliferative effects on vascular cells both in vitro and in vivo, inducing an angiogenic response in vivo. In the vascular cell cycle, it delays the G1 phase and entry into the S phase. In the context of kidney development, SFRP1 inhibits tubule formation and bud growth in metanephroi. Additionally, it hinders WNT1/WNT4-mediated TCF-dependent transcription and interacts with WNT1, WNT2, FRZD6, WNT4, WNT8, and MYOC, emphasizing its multifaceted role in cellular processes and molecular interactions.

Biological Activity

Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells and the ED50 is typically 5-30 μg/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8N474 (S32-K314)

Gene ID
Molecular Construction
N-term
SFRP1 (S32-K314)
Accession # Q8N474
His
C-term
Synonyms
FRP1; FrzA; SARP-2; secreted frizzled-related protein 1; sFRP1
AA Sequence

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SFRP1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SFRP1 Protein, Human (HEK293, His)
Cat. No.:
HY-P74554
Quantity:
MCE Japan Authorized Agent: