1. Recombinant Proteins
  2. Others
  3. SFRP2 Protein, Human (HEK293, His)

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag. The total length of SFRP2 Protein, Human (HEK293, His) is 271 a.a., with molecular weight of 33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag. The total length of SFRP2 Protein, Human (HEK293, His) is 271 a.a., with molecular weight of 33 kDa.

Background

Secreted frizzled-related protein 2 (SFRP2) is a soluble frizzled-related protein that activates the Wnt/β-catenin signaling pathway through DNA demethylation regulation. SFRP2 contains a cysteine-rich domain that is a soluble regulator of Wnt signaling. SFRP2 can differentiate human induced pluripotent stem cells into mature cardiomyocytes. Overexpression of SFRP2 induces osteoblast-like phenotype in prostate cancer cells. SFRP2 promotes carcinogenesis and radiation resistance of glioma cells by activating the Wnt/β-catenin signaling pathway. SFRP2 promoter is hypermethylated in a variety of malignancies and overexpressed in a variety of tumor cells, which may be associated with tumorigenesis. SFRP2 can be used as a non-invasive biomarker for HBV-associated hepatocellular carcinoma[1][2][3][4][5].

Biological Activity

Measured by its ability to synergize with Wnt-3a to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 28.27 ng/mL in the presence of 20 ng/mL of Recombinant Mouse Wnt-3a, corresponding to a specific activity is 3.54×104 units/mg.

  • Measured by its ability to synergize with Wnt-3a to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 28.27 ng/mL in the presence of 20 ng/mL of Recombinant Mouse Wnt-3a, corresponding to a specific activity is 3.54×104 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96HF1 (L25-C295)

Gene ID

6423

Molecular Construction
N-term
SFRP2 (L25-C295)
Accession # Q96HF1
His
C-term
Synonyms
sFRP-2; SARP-1; Sarp1; Sdf5; Sfrp2; AI851596
AA Sequence

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Molecular Weight

Approximately 33 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SFRP2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SFRP2 Protein, Human (HEK293, His)
Cat. No.:
HY-P77835A
Quantity:
MCE Japan Authorized Agent: