SHH Protein, Mouse (HEK293)

SHH Protein, Mouse (HEK293) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Sonic hedgehog (Shh) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation^[1]. Sonic hedgehog (Shh) plays a critical role in post-natal skeletal muscle regeneration. Sonic hedgehog (Shh) is a crucial morphogen that regulates epithelial-mesenchymal interactions during embryogenesis. In adults, the Shh pathway has been shown to be up-regulated following skeletal muscle and myocardium ischemia, suggesting that the embryonic Shh pathway can be recruited^[2].

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.1110-0.1969 μg/mL.

• 
  Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.1110 μg/mL, corresponding to a specific activity is 9009.009 units/mg.

Mouse

HEK293

Tag Free

Q62226 (C25-G198)

20423  [NCBI]

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.