SHH Protein, Mouse

SHH Protein, Mouse is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Sonic hedgehog (Shh) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation^[1]. Sonic hedgehog (Shh) plays a critical role in post-natal skeletal muscle regeneration. Sonic hedgehog (Shh) is a crucial morphogen that regulates epithelial-mesenchymal interactions during embryogenesis. In adults, the Shh pathway has been shown to be up-regulated following skeletal muscle and myocardium ischemia, suggesting that the embryonic Shh pathway can be recruited^[2].

The ED₅₀ is <1 μg/mL as measured by C3H/10T1/2 (CCL-226) cells, corresponding to a specific activity of >1.0 × 10³ units/mg.

• 
  Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.05569 µg/mL, corresponding to a specific activity is 1.80×10⁴ U/mg units/mg.

Mouse

E. coli

Tag Free

Q62226 (C25-G198, C25I-V-I)

20423  [NCBI]

IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Approximately 19.8 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73(2):291-303.  [Content Brief]

  [2]. Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43(5):1813-1828.  [Content Brief]