SIGIRR Protein, Mouse (HEK293, His)

SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

SIGIRR Protein serves as a negative regulator within the Toll-like and IL-1R receptor signaling pathways, exerting its inhibitory effects by attenuating the recruitment of receptor-proximal signaling components to the TLR4 receptor, possibly through a TIR-TIR domain interaction with TLR4. Additionally, through its extracellular domain, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP. The protein interacts with IL1R1, IRAK1, TLR4, TLR5, TLR9, and TRAF6, and upon IL-1 stimulation, it is found in a complex with IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Moreover, upon stimulation with LPC, SIGIRR is part of a complex that includes TLR4, SIG1IR, MYD88, IRAK1, and TRAF6. It also interacts with PALM3, suggesting a multifaceted role in modulating inflammatory signaling pathways.

Mouse

HEK293

C-His

Q9JLZ8 (M1-H117)

24058  [NCBI]

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Approximately 20-40 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.