Siglec-3/CD33 Protein, Mouse (G236R, HEK293, His)

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Mouse (G236R, HEK293, His) is the recombinant mouse-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Siglec-3/CD33 Protein, Mouse (G236R, HEK293, His) is 223 a.a., with molecular weight of 30-45 kDa.

Siglec-3/CD33, a sialic-acid-binding immunoglobulin-like lectin, plays a crucial role in mediating cell-cell interactions and maintaining immune cells in a resting state. It exhibits a preference for binding sialic acid on the short O-linked glycans of specific mucins. The protein forms homodimers through disulfide linkages and interacts with signaling molecules such as PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. Additionally, CD33 engages with C1QA via its C-terminus, leading to the activation of CD33 inhibitory motifs.

Mouse

HEK293

C-6*His

Q63994 (D18-E240)

12489  [NCBI]

DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSRQMRE

30-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.