SIRP alpha/CD172a Protein, Mouse (HEK293, His)

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.

SIRP alpha/CD172a Protein functions as an immunoglobulin-like cell surface receptor for CD47, facilitating the translocation of PTPN6, PTPN11, and other binding partners from the cytosol to the plasma membrane. This receptor plays a crucial role in various cellular processes, including supporting adhesion of cerebellar neurons, promoting neurite outgrowth, and facilitating glial cell attachment. Additionally, SIRP alpha/CD172a is implicated in intracellular signaling during synaptogenesis and synaptic function. Its negative regulatory role extends to receptor tyrosine kinase-coupled responses induced by cell adhesion, growth factors, or insulin. Furthermore, SIRP alpha/CD172a participates in the negative modulation of phagocytosis, mast cell activation, and dendritic cell activation, with CD47 binding preventing dendritic cell maturation and inhibiting cytokine production. Notably, it contributes to antiviral immunity by limiting new world arenavirus infection, specifically by decreasing virus internalization. The receptor also interacts with THBS1, participating in ROS signaling in non-phagocytic cells and stimulating NADPH oxidase-derived ROS production. SIRP alpha/CD172a engages in diverse protein interactions, including binding to PTPN11, GRB2, FGR, JAK2, SCAP1, SCAP2, FYB1, PTK2B, and TRIM2.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse SIRP alpha/CD172a is present at 1 μg/mL, 100 μL/well can bind Mouse CD47(HY-P78711). The ED₅₀ for this effect is 0.2544 μg/mL.

Mouse

HEK293

C-6*His

P97797-1/Q6P6I8/BAA13520.1 (K32-N373)

19261  [NCBI]

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

Approximately 55-110 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.