1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Dendritic Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. SIRP alpha/CD172a Immunoglobulin-like Cell Adhesion Molecules
  5. SIRP alpha/CD172a
  6. SIRP alpha/CD172a Protein, Mouse (HEK293, His)

SIRP alpha/CD172a Protein, Mouse (HEK293, His)

Cat. No.: HY-P72468
SDS COA Handling Instructions Technical Support

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.

Background

SIRP alpha/CD172a Protein functions as an immunoglobulin-like cell surface receptor for CD47, facilitating the translocation of PTPN6, PTPN11, and other binding partners from the cytosol to the plasma membrane. This receptor plays a crucial role in various cellular processes, including supporting adhesion of cerebellar neurons, promoting neurite outgrowth, and facilitating glial cell attachment. Additionally, SIRP alpha/CD172a is implicated in intracellular signaling during synaptogenesis and synaptic function. Its negative regulatory role extends to receptor tyrosine kinase-coupled responses induced by cell adhesion, growth factors, or insulin. Furthermore, SIRP alpha/CD172a participates in the negative modulation of phagocytosis, mast cell activation, and dendritic cell activation, with CD47 binding preventing dendritic cell maturation and inhibiting cytokine production. Notably, it contributes to antiviral immunity by limiting new world arenavirus infection, specifically by decreasing virus internalization. The receptor also interacts with THBS1, participating in ROS signaling in non-phagocytic cells and stimulating NADPH oxidase-derived ROS production. SIRP alpha/CD172a engages in diverse protein interactions, including binding to PTPN11, GRB2, FGR, JAK2, SCAP1, SCAP2, FYB1, PTK2B, and TRIM2.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse SIRP alpha/CD172a is present at 1 μg/mL, 100 μL/well can bind Mouse CD47(HY-P78711). The ED50 for this effect is 0.2544 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P97797-1/Q6P6I8/BAA13520.1 (K32-N373)

Gene ID
Molecular Construction
N-term
CD172a (K32-N373)
Accession # P97797-1
6*His
C-term
Synonyms
Signal-regulatory protein alpha; CD172a; SIRP alpha; SIRPA; MFR; SHPS1; SIRP
AA Sequence

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

Molecular Weight

Approximately 55-110 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SIRP alpha/CD172a Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIRP alpha/CD172a Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72468
Quantity:
MCE Japan Authorized Agent: