1. Recombinant Proteins
  2. Biotinylated Proteins
  3. SKP1 Protein, Human (Biotinylated, His-Avi)

The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag. The total length of SKP1 Protein, Human (Biotinylated, His-Avi) is 162 a.a., with molecular weight of 23-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag. The total length of SKP1 Protein, Human (Biotinylated, His-Avi) is 162 a.a., with molecular weight of 23-28 kDa.

Background

SKP1, an indispensable component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, plays a crucial role in orchestrating the ubiquitination of proteins involved in diverse cellular processes, including cell cycle progression, signal transduction, and transcription. Within the SCF complex, SKP1 serves as an essential adapter, bridging the F-box protein to CUL1 and, consequently, facilitating the substrate recognition function of the SCF complex. The specificity of SCF-mediated ubiquitination is contingent on the F-box protein's unique substrate recognition capabilities. Several F-box proteins within the SCF complex, such as BTRC, FBXW11, SKP2, FBXW7, FBXO32, and others, are implicated in directing ubiquitination events targeting key regulatory proteins involved in Wnt signaling, NF-kappa-B activation, G1/S transition regulation, and diverse cellular pathways. This intricate network of interactions highlights SKP1's pivotal role as a molecular adapter in the SCF ubiquitin ligase complex, governing the dynamic regulation of protein modification through ubiquitination.

Species

Human

Source

HEK293

Tag

C-Avi;N-His

Accession

P63208 (P2-K163)

Gene ID
Molecular Construction
N-term
His
SKP1 (P2-K163)
Accession # P63208
Avi
C-term
Synonyms
S-phase kinase-associated protein 1; p19A; OCP-2; p19skp1; EMC19; SKP1A; TCEB1L
AA Sequence

PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Molecular Weight

23-28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SKP1 Protein, Human (Biotinylated, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SKP1 Protein, Human (Biotinylated, His-Avi)
Cat. No.:
HY-P76644
Quantity:
MCE Japan Authorized Agent: