SLAMF8 Protein, Mouse (HEK293, His)

SLAMF8 protein may contribute to B-lineage commitment and modulation of B-cell receptor signaling, playing a crucial role in B-cell development and immune responses. Exploring its molecular mechanisms and downstream effects could provide insights into its significance in B-cell biology. SLAMF8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SLAMF8 Protein, Mouse (HEK293, His) is 211 a.a., with molecular weight of 32-38 kDa.

The SLAMF8 protein emerges as a potential participant in B-lineage commitment, suggesting a role in the developmental processes that guide the differentiation of B-cells. Furthermore, SLAMF8 may be involved in modulating signaling through the B-cell receptor, indicating its influence on crucial cellular pathways associated with B-cell function. The dual potential of SLAMF8 in both B-lineage commitment and the regulation of B-cell receptor signaling underscores its importance in orchestrating key events in B-cell development and immune responses. Further exploration into the specific molecular mechanisms and downstream effects of SLAMF8 in these contexts could provide valuable insights into its functional significance and potential implications for B-cell biology.

Mouse

HEK293

C-6*His

Q9D3G2 (V21-D231)

74748  [NCBI]

VQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKD

32-38 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.