SLC7A11 Protein, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SLC7A11 Protein, Human (Cell-Free, His) is 501 a.a., with molecular weight of 58.2 kDa.

SLC7A11 Protein, forming a heterodimer with SLC3A2, operates as an antiporter, facilitating the exchange of extracellular anionic L-cystine for intracellular L-glutamate across the cellular plasma membrane. This sodium-independent, electroneutral transport, with a stoichiometry of 1:1, is propelled by the high intracellular concentration of L-glutamate and the intracellular reduction of L-cystine. The pivotal role of SLC7A11 extends to providing L-cystine for maintaining the redox balance between extracellular L-cystine and L-cysteine, essential for cellular protection against oxidative stress. Additionally, it mediates the import of L-kynurenine, contributing to anti-ferroptotic signaling that is crucial for L-cystine and glutathione homeostasis. Furthermore, SLC7A11 facilitates N-acetyl-L-cysteine uptake into the placenta, leading to the down-regulation of oxidative stress, inflammation, and apoptosis-associated pathways. In vitro, the protein exhibits the ability to transport L-aspartate. Beyond its transport functions, SLC7A11 may play a role in astrocyte and meningeal cell proliferation during development, offering neuroprotection by promoting glutathione synthesis and delivery from non-neuronal cells, such as astrocytes and meningeal cells, to immature neurons. Notably, it controls the direct production of pheomelanin pigment.

Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 μg/mL can bind Anti-SLC7A11 antibody, the EC₅₀ is 1.964-2.793 ng/mL.

Human

E. coli Cell-free

N-10*His

Q9UPY5 (M1-L501)

23657

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

58.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 25 mM HEPES, 150 mM NaCl, 0.05% Brij-78, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.