1. Recombinant Proteins
  2. Others
  3. SMR3B Protein, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag. The total length of SMR3B Protein, Human (HEK293, His) is 79 a.a., with molecular weight of ~8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag. The total length of SMR3B Protein, Human (HEK293, His) is 79 a.a., with molecular weight of ~8 kDa.

Background

Submaxillary gland androgen-regulated protein 3B (SMR3B) is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. Importantly, its tumor specific expression in a broad range of cancers and absence in normal tissues make it an attractive target[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P02814/NP_006676.1 (Q23-P79)

Gene ID

10879  [NCBI]

Molecular Construction
N-term
SMR3B (M1-P79)
Accession # P02814
His
C-term
Synonyms
Submaxillary gland androgen-regulated protein 3B; PBII; PRL3; PROL3
AA Sequence

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Molecular Weight

Approximately 9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SMR3B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMR3B Protein, Human (HEK293, His)
Cat. No.:
HY-P77491
Quantity:
MCE Japan Authorized Agent: