SOD2/Mn-SOD Protein, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SOD2/Mn-SOD Protein, Human (HEK293, His) is 198 a.a., with molecular weight of ~25.0 kDa.

The subject, SOD2/Mn-SOD Protein, serves as a crucial enzyme in cellular defense by effectively neutralizing superoxide anion radicals, which are naturally generated within cells and can be toxic to biological systems. Operating as a manganese-containing superoxide dismutase, SOD2 plays a pivotal role in breaking down these radicals, thereby safeguarding cells from the harmful effects of oxidative stress. The enzymatic activity of SOD2 is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species, highlighting its significance in cellular health and resilience.

Specific actifity is 66.28 U/mg, in which one unit will inhibit percentage of xanthine oxidase by 50% in a coupled system, as measured under the described conditions.

Human

HEK293

C-6*His

P04179 (K25-K222)

6648  [NCBI]

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Approximately 25.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.