SORD Protein, Human (HEK293, His)

SORD Protein is an enzyme that in humans is encoded by the SORD gene. SPRD is a polyol dehydrogenase that catalyzes the reversible NAD+-dependent oxidation of various sugar alcohols. SPRD is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. SORD Protein, Human (HEK293, His) is the recombinant human-derived SORD protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SORD Protein, Human (HEK293, His) is 356 a.a., with molecular weight of 39 kDa.

Sorbitol dehydrogenase (SPRD) is an enzyme that in humans is encoded by the SORD gene. SPRD is a polyol dehydrogenase that catalyzes the reversible NAD+-dependent oxidation of various sugar alcohols, which is mostly active with D-sorbitol (D-glucitol), L-threitol, xylitol and ribitol as substrates, leading to the C2-oxidized products D-fructose, L-erythrulose, D-xylulose, and D-ribulose, respectively. SPRD is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. The polyol pathway is believed to be involved in the etiology of diabetic complications, such as diabetic neuropathy and retinopathy, induced by hyperglycemia. SPRD may play a role in sperm motility by using sorbitol as an alternative energy source for sperm motility. SPRD may have a more general function in the metabolism of secondary alcohols since it also catalyzes the stereospecific oxidation of (2R,3R)-2,3-butanediol^[1][2][3][4].

Human

HEK293

C-6*His

AAH21085.1 (A2-P357)

6652  [NCBI]

AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP

39 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.2 M NaCl, 5 mM DTT, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.