Sortilin/SORT1 Protein, Human (HEK293, His)

The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.

Sortilin (SORT1) protein functions both as a sorting receptor within the Golgi compartment and as a clearance receptor on the cell surface. It plays a crucial role in protein transport from the Golgi apparatus to lysosomes, independent of the mannose-6-phosphate receptor (M6PR). In this process, lysosomal proteins specifically bind to the receptor in the Golgi, forming a receptor-ligand complex that is transported to an acidic prelysosomal compartment. The low pH in this compartment mediates complex dissociation, and the receptor is recycled back to the Golgi via binding to the retromer. Additionally, Sortilin is involved in protein transport from the Golgi to endosomes. It facilitates neuronal apoptosis by mediating the endocytosis of proapoptotic precursor forms of BDNF and NGFB, while also acting as a receptor for neurotensin. In adipocytes, Sortilin is likely required for the formation of specialized storage vesicles containing the glucose transporter SLC2A4 (GLUT4), enhancing responsiveness to insulin. The protein interacts with various partners, including ligands like LRPAP1/RAP, GM2A, and NTS, as well as participating in a complex with NGFR. Sortilin also engages with cytosolic adapter proteins, such as GGA1 and GGA2, and forms interactions with proteins like CLN5, PSAP, GRN, and SMPD1, contributing to its diverse cellular functions.

Immobilized Recombinant Human Sortilin Protein at 4 μg/ml (100 μl/well) can bind Biotinylated Recombinant Human beta -NGF Protein. The ED₅₀ for this effect is ≤273.8 ng/mL.

• 
  Immobilized Recombinant Human Sortilin Protein at 4 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human beta -NGF Protein. The ED₅₀ for this effect is 273.8 ng/mL.

Human

HEK293

C-His

Q99523-1 (S78-N755)

6272  [NCBI]

SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN

Approximately 80-110 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 5% trehalose, 7.4 mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.