1. Recombinant Proteins
  2. Biotinylated Proteins
  3. SOST Protein, Human (Biotinylated, HEK293, His-Avi)

SOST Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78209
SDS COA Handling Instructions

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of SOST Protein, Human (Biotinylated, HEK293, His-Avi) is 190 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $355 In-stock
50 μg $585 In-stock
100 μg $995 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with N-His, N-Avi labeled tag. The total length of SOST Protein, Human (Biotinylated, HEK293, His-Avi) is 190 a.a., with molecular weight of 30-40 kDa.

Background

SOST protein serves as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. Through interactions with key components of the Wnt pathway, including LRP4, LRP5, and LRP6, SOST exerts its inhibitory influence. Notably, its interaction with LRP4, mediated via the extracellular domain, facilitates the suppression of Wnt signaling, while interactions with LRP5, specifically through the first two YWTD-EGF repeat domains, contribute to the inhibition of Wnt-mediated signaling. These molecular interactions underscore the crucial role of SOST in modulating the intricate signaling cascades that govern bone development, providing essential regulatory mechanisms to maintain bone homeostasis.

Biological Activity

Immobilized Anti-SOST Antibody at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human SOST, His Tag with the EC50 of ≤3.9 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-His;N-Avi

Accession

Q9BQB4-1 (Q24-Y213)

Gene ID
Molecular Construction
N-term
His-Avi
SOST (Q24-Y213)
Accession # Q9BQB4-1
C-term
Synonyms
sclerostin; SOST; VBCHsclerosteosis; CDD; DAND6; SOST1; VBCH
AA Sequence

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Molecular Weight

28-40 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, 50mM NaCl (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SOST Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOST Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78209
Quantity:
MCE Japan Authorized Agent: