1. Recombinant Proteins
  2. Others
  3. SOST Protein, Human (HEK293, His)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (HEK293, His) is the recombinant human-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (HEK293, His) is the recombinant human-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag.

Background

SOST protein serves as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. Through interactions with key components of the Wnt pathway, including LRP4, LRP5, and LRP6, SOST exerts its inhibitory influence. Notably, its interaction with LRP4, mediated via the extracellular domain, facilitates the suppression of Wnt signaling, while interactions with LRP5, specifically through the first two YWTD-EGF repeat domains, contribute to the inhibition of Wnt-mediated signaling. These molecular interactions underscore the crucial role of SOST in modulating the intricate signaling cascades that govern bone development, providing essential regulatory mechanisms to maintain bone homeostasis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BQB4-1 (Q24-Y213)

Gene ID
Molecular Construction
N-term
SOST (Q24-Y213)
Accession # Q9BQB4-1
6*His
C-term
Synonyms
Sclerostin; SOST; UNQ2976; PRO7455; PRO7476
AA Sequence

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SOST Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOST Protein, Human (HEK293, His)
Cat. No.:
HY-P70756
Quantity:
MCE Japan Authorized Agent: