SOST Protein, Mouse (HEK293, His)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Mouse (HEK293, His) is the recombinant mouse-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SOST Protein, Mouse (HEK293, His) is 188 a.a., with molecular weight of ~32.0 kDa.

SOST protein serves as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. Through interactions with key components of the Wnt pathway, including LRP4, LRP5, and LRP6, SOST exerts its inhibitory influence. Notably, its interaction with LRP4, mediated via the extracellular domain, facilitates the suppression of Wnt signaling, while interactions with LRP5, specifically through the first two YWTD-EGF repeat domains, contribute to the inhibition of Wnt-mediated signaling. These molecular interactions underscore the crucial role of SOST in modulating the intricate signaling cascades that govern bone development, providing essential regulatory mechanisms to maintain bone homeostasis.

Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 1.080 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 925.9259 units/mg.

• 
  Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 1.080 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 925.9259 units/mg.

Mouse

HEK293

C-6*His

AAK13455.1 (Q24-Y211)

74499  [NCBI]

QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY

Approximately 32.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.