SP-D Protein, Mouse (HEK293, His)

SP-D Protein (SP-D) enhances lung defense against microorganisms, antigens, and toxins.It interacts with lipopolysaccharides, oligosaccharides, and fatty acids, influencing immune responses.SP-D is involved in pulmonary surfactant turnover, maintaining lung homeostasis.It has a strong affinity for maltose residues and alpha-glucosyl moieties.Structurally, SP-D forms an oligomeric complex of homotrimers for effective pulmonary defense.SP-D Protein, Mouse (HEK293, His) is the recombinant mouse-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

Surfactant protein D (SP-D) plays a vital role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifaceted protein interacts with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby modulating leukocyte responses in the immune system. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of lung homeostasis. Notably, SP-D exhibits a robust affinity for maltose residues and other alpha-glucosyl moieties. Structurally, it forms an oligomeric complex consisting of four sets of homotrimers, underscoring its intricate organization in pulmonary defense processes.

Mouse

HEK293

C-6*His

P50404 (A20-F374)

20390  [NCBI]

AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

42-46 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 7.4 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.