1. Recombinant Proteins
  2. Others
  3. SPARC Protein, Human (HEK293, His)

SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Human (HEK293, His) is 286 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

SPARC Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE SPARC Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Human (HEK293, His) is 286 a.a..

Background

APOE is a crucial protein involved in the transport of lipids between organs via plasma and interstitial fluids. It plays a vital role in the production, conversion, and clearance of plasma lipoproteins. APOE interacts with various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, with a particular preference for HDL. It also binds to numerous cellular receptors, such as LDLR and VLDLR, facilitating the uptake of APOE-containing lipoproteins by cells. Additionally, APOE possesses heparin-binding activity and binds to heparan-sulfate proteoglycans on cell surfaces, aiding in the capture and receptor-mediated uptake of APOE-containing lipoproteins. Furthermore, APOE forms a homotetramer and may interact with ABCA1 in HDL biogenesis. It can also interact with APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.

Biological Activity

Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 1.942-2.503 μg/mL.

  • Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 2.503 μg/mL, corresponding to a specific activity is 400 U/mg
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P09486 (A18-I303 )

Gene ID
Molecular Construction
N-term
SPARC (A18-I303 )
Accession # P09486
6*His
C-term
Synonyms
SPARC; Basement-Membrane Protein 40; BM-40; Osteonectin; ON; Secreted Protein Acidic and Rich in Cysteine; SPARC; ON
AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Molecular Weight

Approximately 37-46 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2-7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPARC Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPARC Protein, Human (HEK293, His)
Cat. No.:
HY-P71094
Quantity:
MCE Japan Authorized Agent: