SPINK2 Protein, Human (HEK293, Fc)

SPINK2, a robust acrosin inhibitor, is vital for normal spermiogenesis, preventing premature activation of proacrosin and other proteases to avoid spermiogenesis defects. It likely regulates germ cell apoptosis mediated by serine proteases and displays inhibitory activity against trypsin, indicating involvement in diverse serine protease-dependent processes. SPINK2 Protein, Human (HEK293, Fc) is the recombinant human-derived SPINK2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of SPINK2 Protein, Human (HEK293, Fc) is 61 a.a., with molecular weight of ~33.6-38 kDa.

SPINK2, a potent inhibitor of acrosin, plays a crucial role in ensuring normal spermiogenesis. Its primary function is likely to impede the premature activation of proacrosin and other proteases, thereby preventing the initiation of events that could lead to spermiogenesis defects. SPINK2 may additionally participate in the regulation of germ cell apoptosis mediated by serine proteases. Beyond its role in acrosin inhibition, SPINK2 exhibits inhibitory activity against trypsin, suggesting its involvement in regulating various serine protease-dependent processes.

Human

HEK293

C-hFc

P20155/NP_066937.1 (Q24-C84)

6691  [NCBI]

QFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC

Approximately 33.6-38 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.